Fkbp2 (NM_008020) Mouse Recombinant Protein
CAT#: TP500887
Purified recombinant protein of Mouse FK506 binding protein 2 (Fkbp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200887 protein sequence
Red=Cloning site Green=Tags(s) MRLSWILTILSICLSALAAATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQ NQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRSEL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032046 |
Locus ID | 14227 |
UniProt ID | P45878 |
Refseq Size | 661 |
Cytogenetics | 19 A |
Refseq ORF | 423 |
Synonyms | 13kDa; FKBP-2; mFKBP2; mFKBP13 |
Summary | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |