Nhlh2 (NM_178777) Mouse Recombinant Protein
CAT#: TP500816
Purified recombinant protein of Mouse nescient helix loop helix 2 (Nhlh2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200816 protein sequence
Red=Cloning site Green=Tags(s) MMLSPDQAADSDHPSSTHSDPESLGGADTKVLGSVSDLEPVEEADGDGKGGSRAALYPHPQQLSREEKRR RRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848892 |
Locus ID | 18072 |
UniProt ID | Q64221 |
Refseq Size | 3353 |
Cytogenetics | 3 F2.2 |
Refseq ORF | 408 |
Synonyms | 6230401I09Rik; bHLHa34; Hen2; Nscl-2; NSCL2 |
Summary | May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |