Rida (NM_008287) Mouse Recombinant Protein
CAT#: TP500815
Purified recombinant protein of Mouse reactive intermediate imine deaminase A homolog (Rida), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200815 protein sequence
Red=Cloning site Green=Tags(s) MSSIIRKVISTTKAPAAIGPYSQAVQVDRTIYISGQVGLDPSSGQLVPGGVVEEAKQALKNLGEILKAAG CDFNNVVKTTVLLADMNDFGTVNEIYKTYFQGSLPARAAYQVAALPRGSRVEIEAIAVQGPFIKA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 14.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032313 |
Locus ID | 15473 |
UniProt ID | P52760 |
Refseq Size | 1011 |
Cytogenetics | 15 B3.1 |
Refseq ORF | 408 |
Synonyms | HR12; HRP12; Hrsp12 |
Summary | Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular components. It may act on enamine/imine intermediates formed by several types of pyridoxal-5'-phosphate-dependent dehydratases including L-threonine dehydratase.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |