0610038F07Rik (BC060090) Mouse Recombinant Protein

CAT#: TP500796

Purified recombinant protein of Mouse RIKEN cDNA 0610038F07 gene (cDNA clone MGC:61338 IMAGE:5698361), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
SDHAF2 Antibody - middle region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200796 protein sequence
Red=Cloning site Green=Tags(s)

MAVVTLIPTLARALSKHSLLSPLPSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLY
ESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYYWATGMPYAELHLGIIR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 15.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 66072
UniProt ID Q8C6I2
Refseq Size 3993
Cytogenetics 19 A
Refseq ORF 402
Synonyms MGC61338
Summary Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SDHA of the SDH catalytic dimer.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...