Zfp593 (NM_024215) Mouse Recombinant Protein

CAT#: TP500497

Purified recombinant protein of Mouse zinc finger protein 593 (Zfp593), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200497 protein sequence
Red=Cloning site Green=Tags(s)

MKAKKRRPDLDEIHRELRPQGLPRPKPERDAEPDPDLPGGGLHRCLACARYFIDSANLKTHFRSKDHKKR
LKQLSVEPYSQEEAERAAGMGSYVQPQRLGVPTEVSTDIPEMDTST

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 13.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_077177
Locus ID 68040
UniProt ID Q9DB42
Refseq Size 1991
Cytogenetics 4 D3
Refseq ORF 351
Synonyms 3110024A21Rik; AV062409; E130106C14Rik; ZNF593
Summary Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity. Could act either by binding to DNA octamer or by interacting with Oct-2. May also be a modulator of other octamer-binding proteins (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...