Pf4 (NM_019932) Mouse Recombinant Protein
CAT#: TP500359
Purified recombinant protein of Mouse platelet factor 4 (Pf4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200359 representing NM_019932
Red=Cloning site Green=Tags(s) MSVAAVFRGLRPSPELLLLGLLFLPAVVAVTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRH CAVPQLIATLKNGRKICLDRQAPLYKKVIEKILES myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 11.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064316 |
Locus ID | 56744 |
UniProt ID | Q9Z126 |
Refseq Size | 525 |
Cytogenetics | 5 E1 |
Refseq ORF | 315 |
Synonyms | Cxcl4; Scyb4 |
Summary | Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Critical role of CXCL4 in the lung pathogenesis of influenza (H1N1) respiratory infection.
,null,
Mucosal immunology
,PubMed ID 28120850
[Pf4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723860 | Purified recombinant protein of Mouse platelet factor 4 (Pf4 / PF-4) |
CNY 4,090.00 |