Lsm3 (NM_026309) Mouse Recombinant Protein
CAT#: TP500330
Purified recombinant protein of Mouse LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated (Lsm3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200330 protein sequence
Red=Cloning site Green=Tags(s) MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET YEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 11.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080585 |
Locus ID | 67678 |
UniProt ID | P62311 |
Refseq Size | 631 |
Cytogenetics | 6 D1 |
Refseq ORF | 309 |
Synonyms | 1010001J12Rik; 2610005D18Rik; 6030401D18Rik; SMX4; USS2 |
Summary | Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |