1810020G14Rik (BC005675) Mouse Recombinant Protein
CAT#: TP500115
Purified recombinant protein of Mouse RIKEN cDNA 1810020G14 gene (cDNA clone MGC:11762 IMAGE:3153356), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200115 protein sequence
Red=Cloning site Green=Tags(s) MIAPAVLRALRKNKTLRYGVPMLLLVVGGSFGLREFSQIRYDAVTIKIDPELEKKLKVNKITLESEYERL LCLLCRQ myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 8.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 66272 |
UniProt ID | Q9CR63 |
Refseq Size | 639 |
Cytogenetics | 12 D1 |
Refseq ORF | 231 |
Synonyms | 1810020G14Rik; 1810055I05Rik; BB388670 |
Summary | Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6. Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它1810020G14Rik产品