Pcp4 (NM_008791) Mouse Recombinant Protein
CAT#: TP500038
Purified recombinant protein of Mouse Purkinje cell protein 4 (Pcp4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200038 protein sequence
Red=Cloning site Green=Tags(s) MSERQSAGATNGKDKTSGDNDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 6.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032817 |
Locus ID | 18546 |
UniProt ID | P63054 |
Refseq Size | 669 |
Cytogenetics | 16 56.97 cM |
Refseq ORF | 189 |
Synonyms | P16Rimb19; Pcp-4; Pep19 |
Summary | Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls. For instance, may play a role in neuronal differentiation through activation of calmodulin-dependent kinase signaling pathways.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |