MINPP1 (NM_001178117) Human Recombinant Protein
CAT#: TP329866
Purified recombinant protein of Homo sapiens multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2, 20 µg
View other "MINPP1" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229866 representing NM_001178117
Red=Cloning site Green=Tags(s) MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRD PELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYAD WMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPD VADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNAGL SQFLLQSSSSLVMQRLFFHCFLSWATSKTRNP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 35.1 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001171588 |
Locus ID | 9562 |
UniProt ID | Q9UNW1 |
Cytogenetics | 10q23.2 |
Refseq ORF | 936 |
Synonyms | HIPER1; MINPP2; MIPP |
Summary | This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.[provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417667 | MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432866 | MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417667 | Transient overexpression lysate of multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1) |
CNY 3,080.00 |
|
LY432866 | Transient overexpression lysate of multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2 |
CNY 3,080.00 |
|
PH307581 | MINPP1 MS Standard C13 and N15-labeled recombinant protein (NP_004888) |
CNY 19,520.00 |
|
TP307581 | Recombinant protein of human multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1), 20 µg |
CNY 2,900.00 |
|
TP710176 | Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
TP720678 | Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1 |
CNY 1,800.00 |