CLM 9 (CD300LG) (NM_001168323) Human Recombinant Protein
CAT#: TP329805
Purified recombinant protein of Homo sapiens CD300 molecule-like family member g (CD300LG), transcript variant 3, 20 µg
View other "CLM 9" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229805 representing NM_001168323
Red=Cloning site Green=Tags(s) MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEE GQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPASPGLYPAATTAKQ GKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIP MVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLNSLMFSLSLPWL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.4 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001161795 |
Locus ID | 146894 |
UniProt ID | Q6UXG3 |
Cytogenetics | 17q21.31 |
Refseq ORF | 819 |
Synonyms | CLM-9; CLM9; NEPMUCIN; TREM-4; TREM4 |
Summary | Members of the CD300 (see MIM 606786)-like (CD300L) family, such as CD300LG, are widely expressed on hematopoietic cells. All CD300L proteins are type I cell surface glycoproteins that contain a single immunoglobulin (Ig) V-like domain (Takatsu et al., 2006 [PubMed 16876123]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407998 | CD300LG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432805 | CD300LG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432858 | CD300LG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407998 | Transient overexpression lysate of CD300 molecule-like family member g (CD300LG), transcript variant 1 |
CNY 3,080.00 |
|
LY432805 | Transient overexpression lysate of CD300 molecule-like family member g (CD300LG), transcript variant 3 |
CNY 3,080.00 |
|
LY432858 | Transient overexpression lysate of CD300 molecule-like family member g (CD300LG), transcript variant 4 |
CNY 3,080.00 |
|
TP329858 | Purified recombinant protein of Homo sapiens CD300 molecule-like family member g (CD300LG), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP720464 | Recombinant protein of human CD300 molecule-like family member g (CD300LG), transcript variant 4. |
CNY 3,140.00 |