CD84 (NM_001184881) Human Recombinant Protein
CAT#: TP329804
Purified recombinant protein of Homo sapiens CD84 molecule (CD84), transcript variant 3, 20 µg
View other "CD84" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229804 representing NM_001184881
Red=Cloning site Green=Tags(s) MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSET APVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQS LMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQ LCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQGASLQGRASEHSLFRSAVC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001171810 |
Locus ID | 8832 |
UniProt ID | Q9UIB8 |
Cytogenetics | 1q23.3 |
Refseq ORF | 816 |
Synonyms | hCD84; LY9B; mCD84; SLAMF5 |
Summary | This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401277 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432804 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432917 | CD84 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401277 | Transient overexpression lysate of CD84 molecule (CD84) |
CNY 3,080.00 |
|
LY432804 | Transient overexpression lysate of CD84 molecule (CD84), transcript variant 3 |
CNY 3,080.00 |
|
LY432917 | Transient overexpression lysate of CD84 molecule (CD84), transcript variant 1 |
CNY 3,080.00 |
|
PH304477 | CD84 MS Standard C13 and N15-labeled recombinant protein (NP_003865) |
CNY 14,250.00 |
|
TP304477 | Recombinant protein of human CD84 molecule (CD84), 20 µg |
CNY 2,900.00 |
|
TP723970 | Human SLAMF5 Protein, mFc-His Tag |
CNY 4,925.00 |