TSPAN3 (NM_001168412) Human Recombinant Protein
CAT#: TP329654
Purified recombinant protein of Homo sapiens tetraspanin 3 (TSPAN3), transcript variant 3, 20 µg
View other "TSPAN3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229654 representing NM_001168412
Red=Cloning site Green=Tags(s) MGQCGITSSKTVLVFLNLIFWFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYKTYNGTNPDAA SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKK LQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRDPAYELLITGGTYA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.6 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001161884 |
Locus ID | 10099 |
UniProt ID | O60637 |
Cytogenetics | 15q24.3 |
Refseq ORF | 567 |
Synonyms | TM4-A; TM4SF8; TSPAN-3 |
Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Multiple alternative transcripts encoding different isoforms have been described. [provided by RefSeq, Dec 2009] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417105 | TSPAN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432654 | TSPAN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417105 | Transient overexpression lysate of tetraspanin 3 (TSPAN3), transcript variant 1 |
CNY 3,080.00 |
|
LY432654 | Transient overexpression lysate of tetraspanin 3 (TSPAN3), transcript variant 3 |
CNY 3,080.00 |