C21orf62 (NM_001162495) Human Recombinant Protein
CAT#: TP328766
Purified recombinant protein of Homo sapiens chromosome 21 open reading frame 62 (C21orf62), transcript variant 1, 20 µg
View other "C21orf62" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,999.00
CNY 2,700.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228766 representing NM_001162495
Red=Cloning site Green=Tags(s) MAPPSRHCLLLISTLGVFALNCFTKGQKNSTLIFTRENTIRNCSCSADIRDCDYSLANLMCNCKTVLPLA VERTSYNGHLTIWFTDTSALGHLLNFTLVQDLKLSLCSTNTLPTEYLAICGLKRLRINMEAKHPFPEQSL LIHSGGDSDSREKPMWLHKGWQPCMYISFLDMALFNRDSALKSYSIENVTSIANNFPDFSYFRTFPMPSN KSYVVTFIY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001155967 |
Locus ID | 56245 |
UniProt ID | Q9NYP8 |
Cytogenetics | 21q22.11 |
Refseq ORF | 657 |
Synonyms | B37; C21orf120; PRED81 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412723 | C21orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431794 | C21orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431795 | C21orf62 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412723 | Transient overexpression lysate of chromosome 21 open reading frame 62 (C21orf62), transcript variant 2 |
CNY 3,080.00 |
|
LY431794 | Transient overexpression lysate of chromosome 21 open reading frame 62 (C21orf62), transcript variant 1 |
CNY 3,080.00 |
|
LY431795 | Transient overexpression lysate of chromosome 21 open reading frame 62 (C21orf62), transcript variant 3 |
CNY 3,080.00 |
|
TP328767 | Purified recombinant protein of Homo sapiens chromosome 21 open reading frame 62 (C21orf62), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP760350 | Purified recombinant protein of Homo sapiens chromosome 21 open reading frame 62 (C21orf62), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP760361 | Purified recombinant protein of Human amyloid beta (A4) precursor-like protein 1 (APLP1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它C21orf62产品