PPP1R3G (NM_001145115) Human Recombinant Protein
CAT#: TP327133
Purified recombinant protein of Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 3G (PPP1R3G), 20 µg
View other "PPP1R3G" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC227133 representing NM_001145115
Red=Cloning site Green=Tags(s) MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLSPKEEAAPQEQ EELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLGPGGCCAKCKKRVQFADTLGL SLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGLLAAAAVAAPLSAPPSRLRPLFQLPGPSAAA ERLQRQRVCLERVQCSTASGAEVKGSGRVLSCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAP SGASEPGSGDAKKEPGAECFHFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLR YARPADAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001138587 |
Locus ID | 648791 |
UniProt ID | B7ZBB8 |
Cytogenetics | 6p25.1 |
Refseq ORF | 1074 |
Summary | Glycogen-targeting subunit for protein phosphatase 1 (PP1). Involved in the regulation of hepatic glycogenesis in a manner coupled to the fasting-feeding cycle and distinct from other glycogen-targeting subunits (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Profiling calcium-dependent interactions between Sorcin and intrinsically disordered regions of human proteome.
,null,
Biochimica et biophysica acta. General subjects
,PubMed ID 32305337
[PPP1R3G]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428701 | PPP1R3G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY428701 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 3G (PPP1R3G) |
CNY 3,080.00 |
|
PH327133 | PPP1R3G MS Standard C13 and N15-labeled recombinant protein (NP_001138587) |
CNY 14,250.00 |
其它PPP1R3G产品