CAB39 (NM_001130849) Human Recombinant Protein
CAT#: TP325504
Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 2, 20 µg
View other "CAB39" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225504 protein sequence
Red=Cloning site Green=Tags(s) MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQL AQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIA LNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRF FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001124321 |
Locus ID | 51719 |
UniProt ID | Q9Y376 |
Refseq Size | 3968 |
Cytogenetics | 2q37.1 |
Refseq ORF | 1023 |
Synonyms | CGI-66; MO25 |
Summary | Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | mTOR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402536 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427286 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427287 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402536 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 1 |
CNY 3,080.00 |
|
LY427286 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 2 |
CNY 3,080.00 |
|
LY427287 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 3 |
CNY 3,080.00 |
|
PH304563 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_057373) |
CNY 19,520.00 |
|
PH325504 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124321) |
CNY 19,520.00 |
|
PH325505 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124322) |
CNY 19,520.00 |
|
TP304563 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325505 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 3, 20 µg |
CNY 2,900.00 |