RELL2 (NM_001130029) Human Recombinant Protein
CAT#: TP325425
Recombinant protein of human RELT-like 2 (RELL2), transcript variant 2, 20 µg
View other "RELL2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225425 protein sequence
Red=Cloning site Green=Tags(s) MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPEDDDMNED TVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGPAAPCIHCSRSKR PPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSRGGQDPGGGQGSGGG QPKAGMPAMERLPPERPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEA NGEPSKPDTSDHQVSLPQGAGSM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123501 |
Locus ID | 285613 |
UniProt ID | Q8NC24 |
Refseq Size | 2171 |
Cytogenetics | 5q31.3 |
Refseq ORF | 909 |
Synonyms | C5orf16 |
Summary | Induces activation of MAPK14/p38 cascade, when overexpressed (PubMed:28688764). Induces apoptosis, when overexpressed (PubMed:19969290).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406433 | RELL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427113 | RELL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406433 | Transient overexpression lysate of RELT-like 2 (RELL2), transcript variant 1 |
CNY 3,080.00 |
|
LY427113 | Transient overexpression lysate of RELT-like 2 (RELL2), transcript variant 2 |
CNY 3,080.00 |
|
PH308967 | RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_776189) |
CNY 19,520.00 |
|
PH325425 | RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_001123501) |
CNY 19,520.00 |
|
TP308967 | Recombinant protein of human RELT-like 2 (RELL2), transcript variant 1, 20 µg |
CNY 2,900.00 |