KCTD15 (NM_001129994) Human Recombinant Protein
CAT#: TP325391
Purified recombinant protein of Homo sapiens potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 2, 20 µg
View other "KCTD15" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225391 representing NM_001129994
Red=Cloning site Green=Tags(s) MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSS LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN QDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQE PLD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123466 |
Locus ID | 79047 |
UniProt ID | Q96SI1 |
Cytogenetics | 19q13.11 |
Refseq ORF | 849 |
Summary | During embryonic development, interferes with neural crest formation (By similarity). Inhibits AP2 transcriptional activity by interaction with its activation domain.[UniProtKB/Swiss-Prot Function] |
Protein Families | Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411332 | KCTD15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411332 | Transient overexpression lysate of potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1 |
CNY 3,080.00 |
|
PH300838 | KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_076981) |
CNY 19,520.00 |
|
PH325391 | KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_001123466) |
CNY 14,250.00 |
|
TP300838 | Recombinant protein of human potassium channel tetramerisation domain containing 15 (KCTD15), transcript variant 1, 20 µg |
CNY 2,900.00 |