NHLH2 (NM_001111061) Human Recombinant Protein
CAT#: TP325102
Recombinant protein of human nescient helix loop helix 2 (NHLH2), transcript variant 2, 20 µg
View other "NHLH2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225102 protein sequence
Red=Cloning site Green=Tags(s) MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRR RRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001104531 |
Locus ID | 4808 |
UniProt ID | Q02577 |
Refseq Size | 2501 |
Cytogenetics | 1p13.1 |
Refseq ORF | 405 |
Synonyms | bHLHa34; HEN2; NSCL2 |
Summary | May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417197 | NHLH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426348 | NHLH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417197 | Transient overexpression lysate of nescient helix loop helix 2 (NHLH2), transcript variant 1 |
CNY 3,080.00 |
|
LY426348 | Transient overexpression lysate of nescient helix loop helix 2 (NHLH2), transcript variant 2 |
CNY 3,080.00 |
|
PH325102 | NHLH2 MS Standard C13 and N15-labeled recombinant protein (NP_001104531) |
CNY 19,520.00 |