TOMM6 (NM_001134493) Human Recombinant Protein
CAT#: TP324993
Recombinant protein of human translocase of outer mitochondrial membrane 6 homolog (yeast) (TOMM6), nuclear gene encoding mitochondrial protein, 20 µg
View other "TOMM6" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224993 representing NM_001134493
Red=Cloning site Green=Tags(s) MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAP QPGV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001127965 |
Locus ID | 100188893 |
UniProt ID | Q96B49 |
Cytogenetics | 6p21.1 |
Refseq ORF | 222 |
Synonyms | OBTP; TOM6 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427460 | TOMM6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427460 | Transient overexpression lysate of translocase of outer mitochondrial membrane 6 homolog (yeast) (TOMM6), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
PH324993 | TOMM6 MS Standard C13 and N15-labeled recombinant protein (NP_001127965) |
CNY 19,520.00 |