RANBP3 (NM_007320) Human Recombinant Protein
CAT#: TP324944
Recombinant protein of human RAN binding protein 3 (RANBP3), transcript variant RANBP3-b, 20 µg
View other "RANBP3" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224944 representing NM_007320
Red=Cloning site Green=Tags(s) MADLANEEKPAIAPPVFVFQKDKGQKRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSEER SSGFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQTVPSSGTNGVSLPADCTGAVP AASPDTAAWRSPSEAADEVCALEEKEPQKNESSNASEEEACEKKDPATQQAFVFGQNLRDRVKLINESVD EADMENAGHPSADTPTATNYFLQYISSSLENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANREN AAAESGSESPFQEATPEKESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSW VERGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVF LISASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSDDDDVLAPSGATAAGAGDE GDGQTTGST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_015559 |
Locus ID | 8498 |
UniProt ID | Q9H6Z4, Q9H6Z4-3 |
Refseq Size | 1868 |
Cytogenetics | 19p13.3 |
Refseq ORF | 1497 |
Summary | This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416048 | RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC416049 | RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418541 | RANBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416048 | Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-b |
CNY 4,840.00 |
|
LY416049 | Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-d |
CNY 4,840.00 |
|
LY418541 | Transient overexpression lysate of RAN binding protein 3 (RANBP3), transcript variant RANBP3-a |
CNY 4,840.00 |
|
PH314493 | RANBP3 MS Standard C13 and N15-labeled recombinant protein (NP_015561) |
CNY 14,250.00 |
|
PH324944 | RANBP3 MS Standard C13 and N15-labeled recombinant protein (NP_015559) |
CNY 14,250.00 |
|
TP314493 | Purified recombinant protein of Homo sapiens RAN binding protein 3 (RANBP3), transcript variant RANBP3-d, 20 µg |
CNY 2,900.00 |