Myosin (MYL6) (NM_079423) Human Recombinant Protein
CAT#: TP324925
Recombinant protein of human myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 2, 20 µg
View other "Myosin" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224925 protein sequence
Red=Cloning site Green=Tags(s) MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN YEELVRMVLNG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_524147 |
Locus ID | 4637 |
UniProt ID | P60660 |
Refseq Size | 782 |
Cytogenetics | 12q13.2 |
Refseq ORF | 453 |
Synonyms | ESMLC; LC17; LC17-GI; LC17-NM; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM |
Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409203 | MYL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412144 | MYL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409203 | Transient overexpression lysate of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 2 |
CNY 3,080.00 |
|
LY412144 | Transient overexpression lysate of myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 1 |
CNY 3,080.00 |
|
PH300708 | MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_066299) |
CNY 19,520.00 |
|
PH324925 | MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_524147) |
CNY 19,520.00 |
|
TP300708 | Recombinant protein of human myosin, light chain 6, alkali, smooth muscle and non-muscle (MYL6), transcript variant 1, 20 µg |
CNY 2,900.00 |