OSTF1 (NM_012383) Human Recombinant Protein
CAT#: TP324885
Recombinant protein of human osteoclast stimulating factor 1 (OSTF1), 20 µg
View other "OSTF1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224885 representing NM_012383
Red=Cloning site Green=Tags(s) MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQA ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQNKLG DTALHAAAWKGYADIVQLLLAKGARTDLRNIEKKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDYLDD EDSD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036515 |
Locus ID | 26578 |
UniProt ID | Q92882 |
Refseq Size | 901 |
Cytogenetics | 9q21.13 |
Refseq ORF | 642 |
Synonyms | bA235O14.1; OSF; SH3P2 |
Summary | Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al., 1998 [PubMed 10092216]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415823 | OSTF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415823 | Transient overexpression lysate of osteoclast stimulating factor 1 (OSTF1) |
CNY 3,080.00 |
|
PH324885 | OSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_036515) |
CNY 19,520.00 |