Cyt 19 (AS3MT) (NM_020682) Human Recombinant Protein
CAT#: TP324597
Recombinant protein of human arsenic (+3 oxidation state) methyltransferase (AS3MT), 20 µg
View other "Cyt 19" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224597 representing NM_020682
Red=Cloning site Green=Tags(s) MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLE NCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLG EAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGA LYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGIT GHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLA EESDSMKSRCVPDAAGGCCGTKKSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065733 |
Locus ID | 57412 |
UniProt ID | Q9HBK9 |
Refseq Size | 2477 |
Cytogenetics | 10q24.32 |
Refseq ORF | 1125 |
Synonyms | CYT19 |
Summary | AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412380 | AS3MT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412380 | Transient overexpression lysate of arsenic (+3 oxidation state) methyltransferase (AS3MT) |
CNY 3,080.00 |
|
PH324597 | AS3MT MS Standard C13 and N15-labeled recombinant protein (NP_065733) |
CNY 19,520.00 |
|
TP761233 | Purified recombinant protein of Human arsenic (+3 oxidation state) methyltransferase (AS3MT), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |