C21ORF56 (SPATC1L) (NM_032261) Human Recombinant Protein
CAT#: TP324562
Recombinant protein of human chromosome 21 open reading frame 56 (C21orf56), transcript variant 2, 20 µg
View other "C21ORF56" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224562 protein sequence
Red=Cloning site Green=Tags(s) MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLDRRILAYVFPGVTRLYGFTVA NIPEKIEQTSTKSLDGSVDERKLRELTQRYLALSARLEKLGYSRDVHPAFSEFLINTYGILKQRPDLRAN PLHSSPAALRKLVIDVVPPKFLGDSLLLLNCLCELSKEDGKPLFAW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115637 |
Locus ID | 84221 |
UniProt ID | Q9H0A9 |
Refseq Size | 1181 |
Cytogenetics | 21q22.3 |
Refseq ORF | 558 |
Synonyms | C21orf56 |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Antibody-based Protein Profiling of the Human Chromosome 21
,Mathias Uhlén, Per Oksvold, Cajsa Älgenäs, Carl Hamsten, Linn Fagerberg, Daniel Klevebring, Emma Lundberg, Jacob Odeberg, Fredrik Pontén, Tadashi Kondo, and Åsa Sivertsson,
Mol. Cell. Proteomics, Mar 2012; 11: M111.013458.
[SPATC1L]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410249 | SPATC1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428289 | SPATC1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410249 | Transient overexpression lysate of chromosome 21 open reading frame 56 (C21orf56), transcript variant 2 |
CNY 3,080.00 |
|
LY428289 | Transient overexpression lysate of chromosome 21 open reading frame 56 (C21orf56), transcript variant 1 |
CNY 3,080.00 |
|
PH324562 | C21orf56 MS Standard C13 and N15-labeled recombinant protein (NP_115637) |
CNY 19,520.00 |
其它C21ORF56产品