BLOC1S1 (NM_001487) Human Recombinant Protein
CAT#: TP324412
Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1), 20 µg
View other "BLOC1S1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224412 protein sequence
Red=Cloning site Green=Tags(s) MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001478 |
Locus ID | 2647 |
UniProt ID | P78537 |
Refseq Size | 590 |
Cytogenetics | 12q13.2 |
Refseq ORF | 375 |
Synonyms | BLOS1; BORCS1; GCN5L1; MICoA; RT14 |
Summary | BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419897 | BLOC1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419897 | Transient overexpression lysate of biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1) |
CNY 3,080.00 |
|
PH324412 | BLOC1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001478) |
CNY 19,520.00 |
其它BLOC1S1产品