PRRG2 (NM_000951) Human Recombinant Protein
CAT#: TP324364
Recombinant protein of human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), 20 µg
View other "PRRG2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224364 representing NM_000951
Red=Cloning site Green=Tags(s) MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTPGNLERECLEE RCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILLIVLAGLGAFWYLRWRQHRGQ QPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQALAASGVHDAPPPPYTSLRRPH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000942 |
Locus ID | 5639 |
UniProt ID | O14669 |
Refseq Size | 1167 |
Cytogenetics | 19q13.33 |
Refseq ORF | 606 |
Synonyms | PRGP2 |
Summary | The protein encoded by this gene is a single-pass transmembrane protein containing an N-terminal gamma-carboxyglutamic acid (Gla) domain and tandem Pro/Leu-Pro-Xaa-Tyr (PY) motifs at its C-terminal end. The Gla domain is exposed on the cell surface while the PY motifs are cytoplasmic. The PY motifs of the encoded protein have been shown to interact with YAP1, a WW domain-containing protein. Therefore, it is thought that the encoded protein may be part of a signal transduction pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424446 | PRRG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424446 | Transient overexpression lysate of proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2) |
CNY 3,080.00 |
|
PH324364 | PRRG2 MS Standard C13 and N15-labeled recombinant protein (NP_000942) |
CNY 19,520.00 |
|
TP761765 | Purified recombinant protein of Human proline rich Gla (G-carboxyglutamic acid) 2 (PRRG2), full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |