C14orf181 (NM_207442) Human Recombinant Protein
CAT#: TP324309
Recombinant protein of human chromosome 14 open reading frame 181 (C14orf181), 20 µg
View other "C14orf181" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224309 representing NM_207442
Red=Cloning site Green=Tags(s) MNTYTRSASFTPKTFTFPLAQNRTSHPTTTSKLKYLGRPSPRRDALQANGEGPEVGPGTEEPAHRLPVGS GSAGEAAASLGTARVRSGRAECTAKLAGDGHARLASAFLHRRAALPPPLGTCRPRLGEGGSAPALGPSPR RGRRVSEGLRDSLPPLGSLTLGKSPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997325 |
Locus ID | 400223 |
Refseq Size | 1727 |
Cytogenetics | 14q24.1 |
Refseq ORF | 498 |
Synonyms | FLJ39779 |
Summary | DISCONTINUED: This record has been withdrawn by NCBI and HGNC. This record was defined by AK097098.1, which is not sufficient evidence to define a distinct locus. |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404036 | C14orf181 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404036 | Transient overexpression lysate of chromosome 14 open reading frame 181 (C14orf181) |
CNY 3,080.00 |
|
PH324309 | C14orf181 MS Standard C13 and N15-labeled recombinant protein (NP_997325) |
CNY 19,520.00 |
其它C14orf181产品