PGRP1B (PGLYRP4) (NM_020393) Human Recombinant Protein
CAT#: TP324039
Purified recombinant protein of Homo sapiens peptidoglycan recognition protein 4 (PGLYRP4), 20 µg
View other "PGRP1B" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224039 representing NM_020393
Red=Cloning site Green=Tags(s) MLPWLLVFSALGIQAWGDSSWNKTQAKQVSEGLQYLFENISQLTEKGLPTDVSTTVSRKAWGAEAVGCSI QLTTPVNVLVIHHVPGLECHDQTVCSQRLRELQAHHVHNNSGCDVAYNFLVGDDGRVYEGVGWNIQGVHT QGYNNISLGFAFFGTKKGHSPSPAALSAMENLITYAVQKGHLSSSYVQPLLGKGENCLAPRQKTSLKKAC PGVVPRSVWGARETHCPRMTLPAKYGIIIHTAGRTCNISDECRLLVRDIQSFYIDRLKSCDIGYNFLVGQ DGAIYEGVGWNVQGSSTPGYDDIALGITFMGTFTGIPPNAAALEAAQDLIQCAMVKGYLTPNYLLVGHSD VARTLSPGQALYNIISTWPHFKH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065126 |
Locus ID | 57115 |
UniProt ID | Q96LB8 |
Refseq Size | 1853 |
Cytogenetics | 1q21.3 |
Refseq ORF | 1119 |
Synonyms | PGLYRPIbeta; PGRP-Ibeta; PGRPIB; SBBI67 |
Summary | Summary: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. This antimicrobial protein binds to murein peptidoglycans of Gram-positive bacteria. [provided by RefSeq, Oct 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412496 | PGLYRP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412496 | Transient overexpression lysate of peptidoglycan recognition protein 4 (PGLYRP4) |
CNY 3,080.00 |
|
PH324039 | PGLYRP4 MS Standard C13 and N15-labeled recombinant protein (NP_065126) |
CNY 14,250.00 |
|
TP701070 | Purified recombinant protein of Human peptidoglycan recognition protein 4 (PGLYRP4), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |