AKAP7 (NM_138633) Human Recombinant Protein
CAT#: TP323812L
Recombinant protein of human A kinase (PRKA) anchor protein 7 (AKAP7), transcript variant beta, 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223812 representing NM_138633
Red=Cloning site Green=Tags(s) MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQ YLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_619539 |
Locus ID | 9465 |
UniProt ID | O43687, Q2TAJ5 |
Refseq Size | 2348 |
Cytogenetics | 6q23.2 |
Refseq ORF | 312 |
Synonyms | AKAP15; AKAP18 |
Summary | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Apr 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |