beta Casein (CSN2) (NM_001891) Human Recombinant Protein
CAT#: TP323777
Recombinant protein of human casein beta (CSN2), 20 µg
View other "beta Casein" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223777 protein sequence
Red=Cloning site Green=Tags(s) MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVE PIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLH LPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQI YPVTQPLAPVHNPISV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001882 |
Locus ID | 1447 |
UniProt ID | P05814, W5RWE1 |
Refseq Size | 1078 |
Cytogenetics | 4q13.3 |
Refseq ORF | 678 |
Synonyms | CASB; PDC213 |
Summary | This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. In addition, the C-terminal 14 aa of the protein has antimicrobial activity, especially in preterm milk, displaying antibacterial activity against S. aureus and Y. enterocolitica. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2020] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419688 | CSN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419688 | Transient overexpression lysate of casein beta (CSN2) |
CNY 3,080.00 |
|
PH323777 | CSN2 MS Standard C13 and N15-labeled recombinant protein (NP_001882) |
CNY 19,520.00 |
|
TP721167 | Purified recombinant protein of Human casein beta (CSN2) |
CNY 3,140.00 |
其它beta Casein产品