REG3G (NM_198448) Human Recombinant Protein
CAT#: TP323686
Recombinant protein of human regenerating islet-derived 3 gamma (REG3G), transcript variant 2, 20 µg
View other "REG3G" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223686 protein sequence
Red=Cloning site Green=Tags(s) MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQK RPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTI LNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_940850 |
Locus ID | 130120 |
UniProt ID | Q6UW15 |
Refseq Size | 855 |
Cytogenetics | 2p12 |
Refseq ORF | 525 |
Synonyms | LPPM429; PAP-1B; PAP1B; PAP IB; PAPIB; REG-III; REG III; UNQ429 |
Summary | This gene encodes a member of the regenerating islet-derived genes (REG)3 protein family. These proteins are secreted, C-type lectins with a carbohydrate recognition domain and N-terminal signal peptide. The protein encoded by this gene is an antimicrobial lectin with activity against Gram-positive bacteria. Alternative splicing results in multiple transcript variants encoding multiple isoforms. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404935 | REG3G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423414 | REG3G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404935 | Transient overexpression lysate of regenerating islet-derived 3 gamma (REG3G), transcript variant 2 |
CNY 3,080.00 |
|
LY423414 | Transient overexpression lysate of regenerating islet-derived 3 gamma (REG3G), transcript variant 1 |
CNY 3,080.00 |
|
PH323686 | REG3G MS Standard C13 and N15-labeled recombinant protein (NP_940850) |
CNY 19,520.00 |
|
PH323733 | REG3G MS Standard C13 and N15-labeled recombinant protein (NP_001008388) |
CNY 19,520.00 |
|
TP323733 | Recombinant protein of human regenerating islet-derived 3 gamma (REG3G), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP721105 | Purified recombinant protein of Human regenerating islet-derived 3 gamma (REG3G), transcript variant 2 |
CNY 3,140.00 |