United States
Germany
Japan
United Kingdom
China
Annexin A11 (ANXA11) (NM_145869) Human Recombinant Protein
CAT＃: TP323654
Recombinant protein of human annexin A11 (ANXA11), transcript variant c, 20 µg
View other "Annexin A11" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223654 representing NM_145869
Red=Cloning site Green=Tags(s) MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS GDYRKILLKICGGND myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 54.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_665876 |
| Locus ID | 311 |
| UniProt ID | P50995 |
| Refseq Size | 2731 |
| Cytogenetics | 10q22.3 |
| Refseq ORF | 1515 |
| Synonyms | ALS23; ANX11; CAP-50; CAP50 |
| Summary | This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. [provided by RefSeq, Dec 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403443 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC407850 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420097 | ANXA11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403443 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant c |
CNY 4,840.00 |
|
| LY407850 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant b |
CNY 3,080.00 |
|
| LY420097 | Transient overexpression lysate of annexin A11 (ANXA11), transcript variant a |
CNY 3,080.00 |
|
| PH303530 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665875) |
CNY 19,520.00 |
|
| PH312191 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_001148) |
CNY 19,520.00 |
|
| PH323654 | ANXA11 MS Standard C13 and N15-labeled recombinant protein (NP_665876) |
CNY 19,520.00 |
|
| TP303530 | Recombinant protein of human annexin A11 (ANXA11), transcript variant b, 20 µg |
CNY 2,900.00 |
|
| TP312191 | Recombinant protein of human annexin A11 (ANXA11), transcript variant a, 20 µg |
CNY 2,900.00 |
其它Annexin A11产品
