Orosomucoid 2 (ORM2) (NM_000608) Human Recombinant Protein
CAT#: TP323213
Recombinant protein of human orosomucoid 2 (ORM2), 20 µg
View other "Orosomucoid 2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223213 protein sequence
Red=Cloning site Green=Tags(s) MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFT PNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNW GLSFYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000599 |
Locus ID | 5005 |
UniProt ID | P19652 |
Refseq Size | 844 |
Cytogenetics | 9q32 |
Refseq ORF | 603 |
Synonyms | AGP-B; AGP-B'; AGP2 |
Summary | This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved in aspects of immunosuppression. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424609 | ORM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424609 | Transient overexpression lysate of orosomucoid 2 (ORM2) |
CNY 3,080.00 |
|
PH323213 | ORM2 MS Standard C13 and N15-labeled recombinant protein (NP_000599) |
CNY 19,520.00 |
|
TP720822 | Purified recombinant protein of Human orosomucoid 2 (ORM2) |
CNY 3,140.00 |
其它Orosomucoid 2产品