UBE2V1 (TMEM189-UBE2V1) (NM_199203) Human Recombinant Protein
CAT#: TP323133
Recombinant protein of human TMEM189-UBE2V1 readthrough transcript (TMEM189-UBE2V1), transcript variant 1, 20 µg
View other "UBE2V1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223133 representing NM_199203
Red=Cloning site Green=Tags(s) MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARW EDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNC LVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILP RKHHRIHHVSPHETYFCITTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPR TIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRL MMSKENMKLPQPPEGQCYSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954673 |
Locus ID | 387522 |
UniProt ID | Q13404, A5PLL7 |
Refseq Size | 2852 |
Cytogenetics | 20q13.13 |
Refseq ORF | 1110 |
Synonyms | CROC-1B; CROC1B; KUA-UEV; TMEM189-UBE2V1 |
Summary | The TMEM189-UEV mRNA is an infrequent but naturally occurring read-through transcript of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this read-through mRNA and the function of its protein product has not yet been determined. [provided by RefSeq, Oct 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404692 | TMEM189 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404692 | Transient overexpression lysate of TMEM189-UBE2V1 readthrough (TMEM189-UBE2V1) |
CNY 3,080.00 |
|
PH323133 | TMEM189 MS Standard C13 and N15-labeled recombinant protein (NP_954673) |
CNY 19,520.00 |
|
TP720973 | Purified recombinant protein of Human TMEM189-UBE2V1 readthrough (TMEM189-UBE2V1) |
CNY 3,140.00 |