CES2 (NM_198061) Human Recombinant Protein
CAT#: TP323021
Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2, 20 µg
View other "CES2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223021 representing NM_198061
Red=Cloning site Green=Tags(s) MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTMRLHRL RARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPP EPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWI HGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFG GNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSE ALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRI YDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHF QCSRAPVYFYEFQHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFD QEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 66.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_932327 |
Locus ID | 8824 |
UniProt ID | O00748 |
Refseq Size | 3909 |
Cytogenetics | 16q22.1 |
Refseq ORF | 1821 |
Synonyms | CE-2; CES2A1; iCE; PCE-2 |
Summary | This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401274 | CES2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405086 | CES2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401274 | Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1 |
CNY 3,080.00 |
|
LY405086 | Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2 |
CNY 4,840.00 |
|
PH303009 | CES2 MS Standard C13 and N15-labeled recombinant protein (NP_003860) |
CNY 19,520.00 |
|
PH323021 | CES2 MS Standard C13 and N15-labeled recombinant protein (NP_932327) |
CNY 19,520.00 |
|
TP303009 | Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1, 20 µg |
CNY 2,900.00 |