HIC1 (NM_006497) Human Recombinant Protein
CAT#: TP322752
Purified recombinant protein of Homo sapiens hypermethylated in cancer 1 (HIC1), transcript variant 1, 20 µg
View other "HIC1" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222752 representing NM_006497
Red=Cloning site Green=Tags(s) MLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRAHKNVLAASSAYLKSLVVHDNLLNLDHDMV SPAVFRLVLDFIYTGRLADGAEAAAAAAVAPGAEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLR GGGGGGGGYAPYGRPGRGLRAATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAAL CASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEE AAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERGGDAAVSPGG PPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVC IPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAAGLGPPFGGGGDKVAGAPGGLGELLRPYRC ASCDKSYKDPATLRQHEKTHWLTRPYPCTICGKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLT EHMRIHSGEKPYECQVCGGKFAQQRNLISHMKMHAVGGAAGAAGALAGLGGLPGVPGPDGKGKLDFPEGV FAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLA AGPDGRTIDRFSPT SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 74.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006488 |
Locus ID | 3090 |
UniProt ID | Q14526 |
Refseq Size | 2626 |
Cytogenetics | 17p13.3 |
Refseq ORF | 2142 |
Synonyms | hic-1; ZBTB29; ZNF901 |
Summary | This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2010] |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
Variants in the fetal genome near pro-inflammatory cytokine genes on 2q13 associate with gestational duration
,Liu, X;Helenius, D;Skotte, L;Beaumont, RN;Wielscher, M;Geller, F;Juodakis, J;Mahajan, A;Bradfield, JP;Lin, FTJ;Vogelezang, S;Bustamante, M;Ahluwalia, TS;Pitkänen, N;Wang, CA;Bacelis, J;Borges, MC;Zhang, G;Bedell, BA;Rossi, RM;Skogstrand, K;Peng, S;Thompson, WK;Appadurai, V;Lawlor, DA;Kalliala, I;Power, C;McCarthy, MI;Boyd, HA;Marazita, ML;Hakonarson, H;Hayes, MG;Scholtens, DM;Rivadeneira, F;Jaddoe, VWV;Vinding, RK;Bisgaard, H;Knight, BA;Pahkala, K;Raitakari, O;Helgeland, Ø;Johansson, S;Njølstad, PR;Fadista, J;Schork, AJ;Nudel, R;Miller, DE;Chen, X;Weirauch, MT;Mortensen, PB;Børglum, AD;Nordentoft, M;Mors, O;Hao, K;Ryckman, KK;Hougaard, DM;Kottyan, LC;Pennell, CE;Lyytikainen, LP;Bønnelykke, K;Vrijheid, M;Felix, JF;Lowe, WL;Grant, SFA;Hyppönen, E;Jacobsson, B;Jarvelin, MR;Muglia, LJ;Murray, JC;Freathy, RM;Werge, TM;Melbye, M;Buil, A;Feenstra, B;,
Nat Commun
,PubMed ID 31477735
[HIC1]
|
Variants in the fetal genome near pro-inflammatory cytokine genes on 2q13 are associated with gestational duration
,Liu, X;Helenius, D;Skotte, L;Beaumont, R;Wielscher, M;Geller, F;Juodakis, J;Mahajan, A;Bradfield, J;Lin, F;Vogelezang, S;Bustamante, M;Ahluwalia, T;Pitkänen, N;Wang, C;Bacelis, J;Borges, M;Zhang, G;Bedell, B;Rossi, R;Skogstrand, K;Peng, S;Thompson, W;Appadurai, V;Lawlor, D;Kalliala, I;Power, C;McCarthy, M;Boyd, H;Marazita, M;Hakonarson, H;Hayes, M;Scholtens, D;Rivadeneira, F;Jaddoe, V;Vinding, R;Bisgaard, H;Knight, B;Pahkala, K;Raitakari, O;Helgeland, ;Johansson, S;Njølstad, P;Fadista, J;Schork, A;Nudel, R;Miller, D;Chen, X;Weirauch, M;Mortensen, P;Børglum, A;Nordentoft, M;Mors, O;Hao, K;Ryckman, K;Hougaard, D;Kottyan, L;Pennell, C;Lyytikainen, L;Bønnelykke, K;Vrijheid, M;Felix, J;Lowe, W;Grant, S;Hyppönen, E;Jacobsson, B;Jarvelin, M;Muglia, L;Murray, J;Freathy, R;Werge, T;Melbye, M;Buil, A;Feenstra, B;, ;, ;,
bioRxiv
[HIC1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH322752 | HIC1 MS Standard C13 and N15-labeled recombinant protein (NP_006488) |
CNY 14,250.00 |