SPINT4 (NM_178455) Human Recombinant Protein
CAT#: TP322419L
Purified recombinant protein of Homo sapiens serine peptidase inhibitor, Kunitz type 4 (SPINT4), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222419 representing NM_178455
Red=Cloning site Green=Tags(s) MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFV FSGCNGNLNNFKLKIEREVACVAKYKPPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848550 |
Locus ID | 391253 |
UniProt ID | Q6UDR6, A0A384P5R1, A0A0A0MQW5 |
Refseq Size | 380 |
Cytogenetics | 20q13.12 |
Refseq ORF | 297 |
Synonyms | C20orf137; dJ601O1.1; SPINT3 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |