ERGIC3 (NM_198398) Human Recombinant Protein
CAT#: TP322204
Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 1, 20 µg
View other "ERGIC3" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222204 representing NM_198398
Red=Cloning site Green=Tags(s) MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKI NIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPD RCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKV AGNFHFAPGKSFQQSHVHVHAVEIHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMM FQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFL TGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_938408 |
Locus ID | 51614 |
UniProt ID | Q9Y282 |
Refseq Size | 1383 |
Cytogenetics | 20q11.22 |
Refseq ORF | 1164 |
Synonyms | C2orf47; C20orf47; CGI-54; dJ477O4.2; Erv46; NY-BR-84; PRO0989; SDBCAG84 |
Summary | Possible role in transport between endoplasmic reticulum and Golgi.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402478 | ERGIC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405049 | ERGIC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402478 | Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 2 |
CNY 3,080.00 |
|
LY405049 | Transient overexpression lysate of ERGIC and golgi 3 (ERGIC3), transcript variant 1 |
CNY 3,080.00 |
|
PH304084 | ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_057050) |
CNY 19,520.00 |
|
PH322204 | ERGIC3 MS Standard C13 and N15-labeled recombinant protein (NP_938408) |
CNY 19,520.00 |
|
TP304084 | Recombinant protein of human ERGIC and golgi 3 (ERGIC3), transcript variant 2, 20 µg |
CNY 2,900.00 |