ROPN1B (NM_001012337) Human Recombinant Protein
CAT#: TP322170
Recombinant protein of human ropporin, rhophilin associated protein 1B (ROPN1B), 20 µg
View other "ROPN1B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222170 representing NM_001012337
Red=Cloning site Green=Tags(s) MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPE LLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKI VCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVW LE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001012337 |
Locus ID | 152015 |
UniProt ID | Q9BZX4 |
Refseq Size | 1018 |
Cytogenetics | 3q21.2 |
Refseq ORF | 636 |
Summary | Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423329 | ROPN1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423329 | Transient overexpression lysate of ropporin, rhophilin associated protein 1B (ROPN1B) |
CNY 3,080.00 |
|
PH322170 | ROPN1B MS Standard C13 and N15-labeled recombinant protein (NP_001012337) |
CNY 19,520.00 |