C1orf226 (NM_001085375) Human Recombinant Protein
CAT#: TP322073
Recombinant protein of human chromosome 1 open reading frame 226 (C1orf226), 20 µg
View other "C1orf226" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222073 representing NM_001085375
Red=Cloning site Green=Tags(s) MFENLNTALTPKLQASRSFPHLSKPVAPGSAPLGSGEPGGPGLWVGSSQHLKNLGKAMGAKVNDFLRRKE PSSLGSVGVTEINKTAGAQLASGTDAAPEAWLEDERSVLQETFPRLDPPPPITRKRTPRALKTTQDMLIS SQPVLSSLEYGTEPSPGQAQDSAPTAQPDVPADASQPEATMEREERGKVLPNGEVSLSVPDLIHKDSQDE SKLKMTECRRASSPSLIERNGFKLSLSPISLAESWEDGSPPPQARTSSLDNEGPHPDLLSFE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001078844 |
Locus ID | 400793 |
UniProt ID | A1L170 |
Refseq Size | 4146 |
Cytogenetics | 1q23.3 |
Refseq ORF | 816 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421279 | C1orf226 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427602 | C1orf226 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421279 | Transient overexpression lysate of chromosome 1 open reading frame 226 (C1orf226), transcript variant 2 |
CNY 3,080.00 |
|
LY427602 | Transient overexpression lysate of chromosome 1 open reading frame 226 (C1orf226), transcript variant 1 |
CNY 3,080.00 |
|
PH322073 | C1orf226 MS Standard C13 and N15-labeled recombinant protein (NP_001078844) |
CNY 19,520.00 |
其它C1orf226产品