FAM122B (NM_145284) Human Recombinant Protein
CAT#: TP322071
Recombinant protein of human family with sequence similarity 122B (FAM122B), 20 µg
View other "FAM122B" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222071 representing NM_145284
Red=Cloning site Green=Tags(s) MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLEEGLDMVNRET AHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKMFVSSSGLPPSPVP SPRRFSSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLFQGTTNMLSPDAAQLSDLSSCSDILDGSSS SSGLSSDPLAKGSATAESPVACSNSCSSFILMDDLSPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660327 |
Locus ID | 159090 |
UniProt ID | Q7Z309 |
Refseq Size | 3766 |
Cytogenetics | Xq26.3 |
Refseq ORF | 744 |
Synonyms | SPACIA2 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408007 | FAM122B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432792 | FAM122B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408007 | Transient overexpression lysate of family with sequence similarity 122B (FAM122B), transcript variant 1 |
CNY 3,080.00 |
|
LY432792 | Transient overexpression lysate of family with sequence similarity 122B (FAM122B), transcript variant 4 |
CNY 3,080.00 |
|
PH322071 | FAM122B MS Standard C13 and N15-labeled recombinant protein (NP_660327) |
CNY 19,520.00 |
其它FAM122B产品