SFTPA2B (NM_006926) Human Recombinant Protein
CAT#: TP321900
Recombinant protein of human surfactant protein A2B (SFTPA2B), 20 µg
View other "SFTPA2B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221900 protein sequence
Red=Cloning site Green=Tags(s) MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPP GNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFS SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTN WYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008857 |
Locus ID | 6436 |
Refseq Size | 2190 |
Cytogenetics | 10q22.3 |
Refseq ORF | 744 |
Synonyms | AC068139.3; SFTPA2; SP-2A; SP-A1; SP-A2; SPAII |
Summary | DISCONTINUED: This record has been withdrawn by the HUGO Gene Nomenclature Committee (HGNC), and it has been determined that the sequence is redundant with SFTPA2 (GeneID:729238) in the GRCh37.1 reference assembly. |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416318 | SFTPA2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416318 | Transient overexpression lysate of surfactant protein A2B (SFTPA2B) |
CNY 3,080.00 |
|
PH321900 | SFTPA2B MS Standard C13 and N15-labeled recombinant protein (NP_008857) |
CNY 19,520.00 |
其它SFTPA2B产品