VOPP1 (NM_030796) Human Recombinant Protein
CAT#: TP321464
Recombinant protein of human EGFR-coamplified and overexpressed protein (ECOP), 20 µg
View other "VOPP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221464 representing NM_030796
Red=Cloning site Green=Tags(s) MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMG VLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQV PPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_110423 |
Locus ID | 81552 |
UniProt ID | Q96AW1 |
Refseq Size | 2890 |
Cytogenetics | 7p11.2 |
Refseq ORF | 516 |
Synonyms | ECOP; GASP; WBP1L2 |
Summary | Increases the transcriptional activity of NFKB1 by facilitating its nuclear translocation, DNA-binding and associated apoptotic response, when overexpressed.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403081 | VOPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403081 | Transient overexpression lysate of vesicular, overexpressed in cancer, prosurvival protein 1 (VOPP1) |
CNY 3,080.00 |
|
PH321464 | VOPP1 MS Standard C13 and N15-labeled recombinant protein (NP_110423) |
CNY 19,520.00 |