Uroguanylin (GUCA2B) (NM_007102) Human Recombinant Protein
CAT#: TP321085
Recombinant protein of human guanylate cyclase activator 2B (uroguanylin) (GUCA2B), 20 µg
View other "Uroguanylin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221085 protein sequence
Red=Cloning site Green=Tags(s) MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHP ALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009033 |
Locus ID | 2981 |
UniProt ID | Q16661 |
Refseq Size | 597 |
Cytogenetics | 1p34.2 |
Refseq ORF | 336 |
Synonyms | GCAP-II; UGN |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416197 | GUCA2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416197 | Transient overexpression lysate of guanylate cyclase activator 2B (uroguanylin) (GUCA2B) |
CNY 3,080.00 |
|
PH321085 | GUCA2B MS Standard C13 and N15-labeled recombinant protein (NP_009033) |
CNY 19,520.00 |
其它Uroguanylin产品