CT45A3 (NM_001017435) Human Recombinant Protein
CAT#: TP320924
Purified recombinant protein of Homo sapiens cancer/testis antigen family 45, member A3 (CT45A3), 20 µg
View other "CT45A3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220924 representing NM_001017435
Red=Cloning site Green=Tags(s) MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLD SQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQK YEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001017435 |
Locus ID | 441519 |
UniProt ID | Q8NHU0 |
Refseq Size | 1008 |
Cytogenetics | Xq26.3 |
Refseq ORF | 567 |
Synonyms | CT45-3; CT45-4; CT45.3; CT45.4; CT45A4 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422732 | CT45A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422732 | Transient overexpression lysate of cancer/testis antigen family 45, member A3 (CT45A3) |
CNY 3,080.00 |
|
PH320924 | CT45A3 MS Standard C13 and N15-labeled recombinant protein (NP_001017435) |
CNY 14,250.00 |