PGEA1 (CBY1) (NM_015373) Human Recombinant Protein
CAT#: TP320783
Recombinant protein of human chibby homolog 1 (Drosophila) (CBY1), transcript variant 1, 20 µg
View other "PGEA1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220783 representing NM_015373
Red=Cloning site Green=Tags(s) MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETGVSGGVD RREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 14.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056188 |
Locus ID | 25776 |
UniProt ID | Q9Y3M2 |
Refseq Size | 1147 |
Cytogenetics | 22q13.1 |
Refseq ORF | 378 |
Synonyms | arb1; C22orf2; CBY; Chibby1; HS508I15A; PGEA1; PIGEA-14; PIGEA14 |
Summary | Beta-catenin is a transcriptional activator and oncoprotein involved in the development of several cancers. The protein encoded by this gene interacts directly with the C-terminal region of beta-catenin, inhibiting oncogenic beta-catenin-mediated transcriptional activation by competing with transcription factors for binding to beta-catenin. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414591 | CBY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424136 | CBY1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414591 | Transient overexpression lysate of chibby homolog 1 (Drosophila) (CBY1), transcript variant 1 |
CNY 3,080.00 |
|
LY424136 | Transient overexpression lysate of chibby homolog 1 (Drosophila) (CBY1), transcript variant 2 |
CNY 3,080.00 |
|
PH320783 | CBY1 MS Standard C13 and N15-labeled recombinant protein (NP_056188) |
CNY 19,520.00 |