BTN3A3 (NM_006994) Human Recombinant Protein
CAT#: TP320673
Recombinant protein of human butyrophilin, subfamily 3, member A3 (BTN3A3), transcript variant 1, 20 µg
View other "BTN3A3" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220673 representing NM_006994
Red=Cloning site Green=Tags(s) MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSS SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE LKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIM RGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIAL SRETEREREMKEMGYAATEQEISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTAN AILLVSEDQRSVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK GWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDGSHIYTFPHAS FSEPLYPVFRILTLEPTALTICPIPKEVESSPDPDLVPDHSLETPLTPGLANESGEPQAEVTSLLLPAHP GAEVSPSATTNQNHKLQARTEALY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 64.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008925 |
Locus ID | 10384 |
UniProt ID | O00478, A0A024R042 |
Refseq Size | 2956 |
Cytogenetics | 6p22.2 |
Refseq ORF | 1752 |
Synonyms | BTF3; BTN3.3 |
Summary | The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene (MIM 601610) and the BTN2 (e.g., BTN2A1; MIM 613590) and BTN3 (e.g., BNT3A3) genes, which have undergone tandem duplication, resulting in 3 copies of each (summary by Smith et al., 2010 [PubMed 20208008]).[supplied by OMIM, Nov 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416277 | BTN3A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416277 | Transient overexpression lysate of butyrophilin, subfamily 3, member A3 (BTN3A3), transcript variant 1 |
CNY 4,840.00 |
|
PH320673 | BTN3A3 MS Standard C13 and N15-labeled recombinant protein (NP_008925) |
CNY 19,520.00 |
|
TP721101 | Purified recombinant protein of Human butyrophilin, subfamily 3, member A3 (BTN3A3), transcript variant 2 |
CNY 4,360.00 |