Osteocalcin (BGLAP) (NM_199173) Human Recombinant Protein
CAT#: TP320555
Recombinant protein of human bone gamma-carboxyglutamate (gla) protein (BGLAP), 20 µg
View other "Osteocalcin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220555 representing NM_199173
Red=Cloning site Green=Tags(s) MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR REVCELNPDCDELADHIGFQEAYRRFYGPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_954642 |
Locus ID | 632 |
UniProt ID | P02818 |
Refseq Size | 498 |
Cytogenetics | 1q22 |
Refseq ORF | 300 |
Synonyms | BGP; OC; OCN |
Summary | This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015] |
Protein Families | ES Cell Differentiation/IPS, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404673 | BGLAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404673 | Transient overexpression lysate of bone gamma-carboxyglutamate (gla) protein (BGLAP) |
CNY 3,080.00 |
|
PH320555 | BGLAP MS Standard C13 and N15-labeled recombinant protein (NP_954642) |
CNY 19,520.00 |
|
TP701039 | Purified recombinant protein of Human bone gamma-carboxyglutamate (gla) protein (BGLAP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |
其它Osteocalcin产品