Spastin (SPAST) (NM_014946) Human Recombinant Protein
CAT#: TP320458
Recombinant protein of human spastin (SPAST), transcript variant 1, 20 µg
View other "Spastin" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220458 representing NM_014946
Red=Cloning site Green=Tags(s) MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESQHKRNLYYFSYPLFVGFALLRLVAFH LGLLFVWLCQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAG QKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLEKMQPVLPFSKSQTD VYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQ GSGPAPTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLA KQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGE KLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQ ELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGP IRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 67 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055761 |
Locus ID | 6683 |
UniProt ID | Q9UBP0 |
Refseq Size | 5221 |
Cytogenetics | 2p22.3 |
Refseq ORF | 1848 |
Synonyms | ADPSP; FSP2; SPG4 |
Summary | This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The use of alternative translational initiation sites in this gene results in a single transcript variant that can produce isoforms that differ in the length of their N-terminus and which thereby differ in the efficiency of their export from the nucleus to the cytoplasm. In addition, alternative splicing results in multiple transcript variants that encode isoforms that differ in other protein regions as well. One isoform of this gene has been shown to be a microtubule-severing enzyme that regulates microtubule abundance, mobility, and plus-end distribution. Mutations in this gene cause the most frequent form of autosomal dominant spastic paraplegia 4. [provided by RefSeq, May 2018] |
Protein Families | Druggable Genome, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
HIPK2 Phosphorylates the Microtubule-Severing Enzyme Spastin at S268 for Abscission
,Pisciottani, A;Biancolillo, L;Ferrara, M;Valente, D;Sardina, F;Monteonofrio, L;Camerini, S;Crescenzi, M;Soddu, S;Rinaldo, C;,
Cells
,PubMed ID 31284535
[SPAST]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404560 | SPAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY404560 | Transient overexpression lysate of spastin (SPAST), transcript variant 2 |
CNY 4,840.00 |
|
PH314100 | SPAST MS Standard C13 and N15-labeled recombinant protein (NP_955468) |
CNY 14,250.00 |
|
PH320458 | SPAST MS Standard C13 and N15-labeled recombinant protein (NP_055761) |
CNY 14,250.00 |
|
TP314100 | Recombinant protein of human spastin (SPAST), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Spastin产品